MTF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 8 publications

Supplier:  Novus Biologicals NBP18638025UL

Catalog No. NB431989

Description

MTF1 Polyclonal specifically detects MTF1 in Human, Mouse, Bovine samples. It is validated for Western Blot, Chromatin Immunoprecipitation, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.

Specifications

• Antigen: MTF1
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin Reported in scientific literature (PMID: 24529376)., Immunohistochemistry-Frozen Reported in scientific literature (PMID 24529376 ).
• Gene Alias: metal regulatory transcription factor 1, metal-regulatory transcription factor 1, metal-responsive transcription factor 1, MGC23036, MRE-binding transcription factor, MRE-binding transcription factor-1, MTF-1, Transcription factor MTF-1, zinc regulatory factor, ZRF
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4520
• Target Species: Bovine, Mouse, Bovine
• Isotype: IgG

• Applications: Immunocytochemistry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: MTF1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:EHSPDNNIIYFEAEEDELTPDDKMLRFVDKNGLVPSSSGTVYDRTTVLIEQDPGTLEDEDDDGQCG
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human MTF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only