MTF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 8 publications

Catalog Number	Mfr. No.	Quantity
NB431989	Novus Biologicals NBP18638025UL	25 μL
NBP186380	Novus Biologicals NBP186380	0.1 mL

Description

MTF1 Polyclonal specifically detects MTF1 in Human, Mouse, Bovine samples. It is validated for Western Blot, Chromatin Immunoprecipitation, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.

Specifications

• Antigen: MTF1
• Classification: Polyclonal
• Host Species: Rabbit
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 4520
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:EHSPDNNIIYFEAEEDELTPDDKMLRFVDKNGLVPSSSGTVYDRTTVLIEQDPGTLEDEDDDGQCG
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin Reported in scientific literature (PMID: 24529376)., Immunohistochemistry-Frozen Reported in scientific literature (PMID 24529376 ).
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Gene Alias: metal regulatory transcription factor 1, metal-regulatory transcription factor 1, metal-responsive transcription factor 1, MGC23036, MRE-binding transcription factor, MRE-binding transcription factor-1, MTF-1, Transcription factor MTF-1, zinc regulatory factor, ZRF
• Gene Symbols: MTF1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of human MTF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only