Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MTHFD1L Antibody, Novus Biologicals™
SDP

Catalog No. NBP257852 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP257852 100 μL
NB393746 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP257852 Supplier Novus Biologicals Supplier No. NBP257852
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

MTHFD1L Polyclonal specifically detects MTHFD1L in Human samples. It is validated for Western Blot, Simple Western, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen MTHFD1L
Applications Western Blot, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 - 0.4 μg/mL, Simple Western, Immunocytochemistry/Immunofluorescence 0.25 - 2 μg/mL
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias 10-formyl-THF synthetase, dJ292B18.2, DKFZp586G1517, EC 6.3.4.3, FLJ21145, Formyltetrahydrofolate synthetase, formyltetrahydrofolate synthetase domain containing 1, FTHFSDC1, methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like, mitochondrial C1-tetrahydrofolate synthase, mitochondrial C1-tetrahydrofolate synthetase, monofunctional C1-tetrahydrofolate synthase, mitochondrial, MTC1THFS
Gene Symbols MTHFD1L
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HGSLEAALQCLFQRKGSMTMSIQWKTRQLQSKLHEADIVVLGSPKPEEIPLTWIQPGTTVLNCSHDFLSGKVGCGS
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 25902
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.