Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MTHFD2L Antibody, Novus Biologicals™

MTHFD2L Antibody, Novus Biologicals™
SDP

Catalog No. NBP15646820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15646820 20 μL
NBP156468 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15646820 Supplier Novus Biologicals Supplier No. NBP15646820UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit Polyclonal Antibody

MTHFD2L Polyclonal specifically detects MTHFD2L in Human samples. It is validated for Western Blot.

Specifications

Antigen MTHFD2L
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias FLJ13105, methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like, MGC45532, MGC72244, NADP-dependent methylenetetrahydrofolate dehydrogenase 2-like protein, probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2
Gene Symbols MTHFD2L
Host Species Rabbit
Immunogen Synthetic peptides corresponding to MTHFD2L(methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like) The peptide sequence was selected from the middle region of MTHFD2L. Peptide sequence TGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVT
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 441024
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.