Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MTMR12 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP155211

 View more versions of this product

Catalog No. NBP155211


Add to cart

Description

Description

MTMR12 Polyclonal antibody specifically detects MTMR12 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

MTMR12
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
MTMR12
Synthetic peptides corresponding to MTMR12(myotubularin related protein 12) The peptide sequence was selected from the middle region of MTMR12. Peptide sequence PLYVEKPKLDKGQRKGMRFKHQRQLSLPLTQSKSSPKRGFFREETDHLIK.
86 kDa
100 ul
Protein Phosphatase
Primary
54545
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Western Blot
Western Blot 1:100-1:2000
Q9C0I1
3-PAP3PAP, 3-phosphatase adapter subunit, KIAA1682FLJ20476, myotubularin related protein 12, myotubularin-related protein 12,3-phosphatase adapter protein, Phosphatidylinositol-3 phosphate 3-phosphatase adapter subunit, phosphatidylinositol-3 phosphate 3-phosphatase adaptor subunit, phosphatidylinositol-3-phosphate associated protein, PIP3AP
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit