MTMR12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155211

Catalog No. NBP155211

Description

MTMR12 Polyclonal specifically detects MTMR12 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MTMR12
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 3-PAP3PAP, 3-phosphatase adapter subunit, KIAA1682FLJ20476, myotubularin related protein 12, myotubularin-related protein 12,3-phosphatase adapter protein, Phosphatidylinositol-3 phosphate 3-phosphatase adapter subunit, phosphatidylinositol-3 phosphate 3-phosphatase adaptor subunit, phosphatidylinositol-3-phosphate associated protein, PIP3AP
• Host Species: Rabbit
• Molecular Weight of Antigen: 86 kDa
• Quantity: 100 μL
• Research Discipline: Protein Phosphatase
• Gene ID (Entrez): 54545
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9C0I1
• Gene Symbols: MTMR12
• Immunogen: Synthetic peptides corresponding to MTMR12(myotubularin related protein 12) The peptide sequence was selected from the middle region of MTMR12. Peptide sequence PLYVEKPKLDKGQRKGMRFKHQRQLSLPLTQSKSSPKRGFFREETDHLIK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.