Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MTMR14 Antibody, Novus Biologicals™
SDP

Catalog No. NB397367 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB397367 25 μL
NBP233703 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB397367 Supplier Novus Biologicals Supplier No. NBP23370325UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

MTMR14 Polyclonal specifically detects MTMR14 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

Antigen MTMR14
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q8NCE2
Gene Alias C3orf29FLJ11546, chromosome 3 open reading frame 29, EC 3.1.3.-, egg-derived tyrosine phosphatase homolog, FLJ22405, FLJ46453, FLJ90311, HCV NS5A-transactivated protein 4 splice variant A-binding protein 1, hEDTP, HJUMPY, jumpy, myotubularin related protein 14, myotubularin-related protein 14, NS5ATP4ABP1
Gene Symbols MTMR14
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: DKAQRYADFTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAPLSIPDFLTHSLNIDWSQYQCWDLVQQTQNYLKLL
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 64419
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.