Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MTUS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25720825UL
Description
MTUS1 Polyclonal specifically detects MTUS1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
MTUS1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
Angiotensin-II type 2 receptor-interacting protein, AT2 receptor-binding protein, AT2R binding protein, ATBPATIP1, ATIP, DKFZp586D1519, erythroid differentiation-related, FLJ14295, GK1, KIAA1288DKFZp686F20243, microtubule associated tumor suppressor 1, microtubule-associated tumor suppressor 1, Mitochondrial tumor suppressor 1, mitochondrial tumor suppressor gene 1, MP44, MTSG1AT2 receptor-interacting protein, transcription factor MTSG1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
MTUS1 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SGKVTSEYTDGSQQRLVGEKETQALTPVSDGMEVPNDSALQEFFCLSHDESNSEPHSQSSYRHKEMGQNLRETVSYCLIDDECPLMVPAFDKSEAQVLN | |
25 μL | |
Breast Cancer | |
57509 | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction