Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MUC1 Antibody, Alexa Fluor™ 647, Novus Biologicals™
SDP

Catalog No. NBP160046Y Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP160046Y 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP160046Y Supplier Novus Biologicals Supplier No. NBP160046AF647
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Specifically detects MUC-1 in Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat samples, and it is validated for Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting

MUC1 Polyclonal specifically detects MUC1 in Human, Mouse, Rat, Porcine, Bovine, Equine, Guinea Pig, Goat, Rabbit samples. It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen MUC-1
Applications Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Alexa Fluor 647
Dilution Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin
Formulation 50mM Sodium Borate with 0.05% Sodium Azide
Gene Accession No. Q7Z552
Gene Alias Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, CD227, CD227 antigen, DF3 antigen, EMA, episialin, H23 antigen, H23AG, KL-6, MAM6, MUC-1, MUC1/ZD, mucin 1, cell surface associated, mucin 1, transmembrane, mucin-1, Peanut-reactive urinary mucin, PEMMUC-1/SEC, PEMT, Polymorphic epithelial mucin, PUMMUC-1/X, tumor associated epithelial mucin, Tumor-associated epithelial membrane antigen, Tumor-associated mucin
Gene Symbols MUC1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal of MUC1 [NP_001037855]. Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.
Molecular Weight of Antigen 21 kDa
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Cellular Markers, Extracellular Matrix, Inflammation, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 4582
Target Species Human, Mouse, Rat, Pig, Bovine, Equine, Guinea Pig, Goat, Rabbit
Content And Storage Store at 4C in the dark.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.