Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP16046A70

MUC1 Antibody, Alexa Fluor™ 700, Novus Biologicals™
SDP

Catalog No. NBP16046A70 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16046A70 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP16046A70 Supplier Novus Biologicals Supplier No. NBP160046AF700
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

MUC1 Polyclonal specifically detects MUC1 in Human, Mouse, Rat, Porcine, Bovine, Equine, Guinea Pig, Goat, Rabbit samples. It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen MUC1
Applications Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Alexa Fluor 700
Dilution Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin
Formulation 50 mM sodium borate with 0.05% sodium azide
Gene Alias Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, CD227, CD227 antigen, DF3 antigen, EMA, episialin, H23 antigen, H23AG, KL-6, MAM6, MUC-1, MUC1/ZD, mucin 1, cell surface associated, mucin 1, transmembrane, mucin-1, Peanut-reactive urinary mucin, PEMMUC-1/SEC, PEMT, Polymorphic epithelial mucin, PUMMUC-1/X, tumor associated epithelial mucin, Tumor-associated epithelial membrane antigen, Tumor-associated mucin
Gene Symbols MUC1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal of MUC1 [NP_001037855]. Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.
Purification Method Affinity Purified
Quantity 0.1 mL
Research Discipline Cancer, Cellular Markers, Extracellular Matrix, Inflammation, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 4582.0
Target Species Human, Mouse, Rat, Pig, Bovine, Equine, Guinea Pig, Goat, Rabbit
Content And Storage Store at 4°C in the dark.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.