Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP160046

MUC1 Antibody - BSA Free, Novus Biologicals™
SDP

Catalog No. NBP160046 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP160046 0.1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP160046 Supplier Novus Biologicals Supplier No. NBP160046
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 4 publications

MUC1 Polyclonal specifically detects MUC1 in Human, Mouse, Rat, Porcine, Bovine, Equine, Guinea Pig, Goat, Rabbit samples. It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen MUC-1
Applications Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 1.0 mg/mL
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml, Flow Cytometry reported in scientific literature (PMID 28740504), Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml, Knockout Validated
Formulation PBS with 0.02% Sodium Azide
Gene Accession No. Q7Z552
Gene Alias Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, CD227, CD227 antigen, DF3 antigen, EMA, episialin, H23 antigen, H23AG, KL-6, MAM6, MUC-1, MUC1/ZD, mucin 1, cell surface associated, mucin 1, transmembrane, mucin-1, Peanut-reactive urinary mucin, PEMMUC-1/SEC, PEMT, Polymorphic epithelial mucin, PUMMUC-1/X, tumor associated epithelial mucin, Tumor-associated epithelial membrane antigen, Tumor-associated mucin
Gene Symbols MUC1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal of MUC1 [NP_001037855]. Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.
Molecular Weight of Antigen 21 kDa
Purification Method Affinity Purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer, Cellular Markers, Extracellular Matrix, Inflammation, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 4582
Test Specificity Expected identity based on immunogen sequence: Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%.
Target Species Human, Mouse, Rat, Pig, Bovine, Equine, Guinea Pig, Goat, Rabbit
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.