MUC1 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 4 publications

Supplier:  Novus Biologicals NBP160046

Catalog No. NBP160046

Description

MUC1 Polyclonal specifically detects MUC1 in Human, Mouse, Rat, Porcine, Bovine, Equine, Guinea Pig, Goat, Rabbit samples. It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MUC-1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS with 0.02% Sodium Azide
• Gene Alias: Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, CD227, CD227 antigen, DF3 antigen, EMA, episialin, H23 antigen, H23AG, KL-6, MAM6, MUC-1, MUC1/ZD, mucin 1, cell surface associated, mucin 1, transmembrane, mucin-1, Peanut-reactive urinary mucin, PEMMUC-1/SEC, PEMT, Polymorphic epithelial mucin, PUMMUC-1/X, tumor associated epithelial mucin, Tumor-associated epithelial membrane antigen, Tumor-associated mucin
• Host Species: Rabbit
• Molecular Weight of Antigen: 21 kDa
• Quantity: 0.1 mg
• Research Discipline: Cancer, Cellular Markers, Extracellular Matrix, Inflammation, Signal Transduction
• Gene ID (Entrez): 4582
• Target Species: Human, Mouse, Rat, Pig, Bovine, Equine, Guinea Pig, Goat, Rabbit
• Isotype: IgG

• Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 1.0 mg/mL
• Dilution: Western Blot 0.2-1 ug/ml, Flow Cytometry reported in scientific literature (PMID 28740504), Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml, Knockout Validated
• Gene Accession No.: Q7Z552
• Gene Symbols: MUC1
• Immunogen: Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal of MUC1 [NP_001037855]. Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

For Research Use Only