Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MUC12 Antibody, Novus Biologicals™

MUC12 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15971920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15971920 20 μL
NBP159719 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15971920 Supplier Novus Biologicals Supplier No. NBP15971920UL

Description

Rabbit Polyclonal Antibody

MUC12 Polyclonal specifically detects MUC12 in Human samples. It is validated for Western Blot.

Specifications

Antigen MUC12
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias MUC11, MUC-11, MUC-12, mucin 11, mucin 12, cell surface associated, mucin-11, mucin-12
Gene Symbols MUC12
Host Species Rabbit
Immunogen Synthetic peptides corresponding to MUC12(mucin 12, cell surface associated) The peptide sequence was selected from the middle region of MUC12. Peptide sequence PSVLVGDSTPSPISSGSMETTALPGSTTKPGLSEKSTTFYSSPRSPDTTH.
Molecular Weight of Antigen 23 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Cancer, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 10071
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.