Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MUC3B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179720

 View more versions of this product

Catalog No. NBP179720


Add to cart

Description

Description

MUC3B Polyclonal antibody specifically detects MUC3B in Human, Bovine samples. It is validated for Western Blot.
Specifications

Specifications

MUC3B
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
intestinal mucin MUC3B, intestinal mucin-3B, MUC3, MUC-3B, mucin 3B, cell surface associated, mucin-3B
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Human: 100%.
Bovine, Human
Western Blot
Western Blot 1:1000
Affinity Purified
MUC3B
Synthetic peptide directed towards the middle region of human MUC3BThe immunogen for this antibody is MUC3B. Peptide sequence KTTLKEGLQNASQDANSCQDSQTLCFKPDSIKVNNNSKTELTPEAICRRA.
Immunogen affinity purified
RUO
Primary
57876
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
SDS
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit