Mucolipin 3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23895125UL

Catalog No. NB396597

Description

Mucolipin 3 Polyclonal specifically detects Mucolipin 3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Mucolipin 3
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q8TDD5
• Gene Symbols: MCOLN3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KGYMDRMDDTYAVYTQSDVYDQLIFAVNQYLQLYNVSVGNHAY
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 55283
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: FLJ11006, FLJ36629, MGC71509, mucolipin 3, mucolipin-3, TRPML3, TRP-ML3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.