Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP159068

MUL1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159068 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159068 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159068 Supplier Novus Biologicals Supplier No. NBP159068
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 2 publications

MUL1 Polyclonal specifically detects MUL1 in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen MUL1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q969V5
Gene Alias C1orf166mitochondrial E3 ubiquitin ligase 1, E3 ubiquitin-protein ligase MUL1, EC 6.3.2, EC 6.3.2.-, FLJ12875, GIDERP11-401M16.2, Growth inhibition and death E3 ligase, MAPLE3 ubiquitin ligase, mitochondrial E3 ubiquitin protein ligase 1, mitochondrial ubiquitin ligase activator of NF-kB, mitochondrial ubiquitin ligase activator of NFKB 1, Mitochondrial-anchored protein ligase, MULANchromosome 1 open reading frame 166, Putative NF-kappa-B-activating protein 266, RING finger protein 218, RNF218mitochondria-anchored protein ligase
Gene Symbols MUL1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to C1ORF166 The peptide sequence was selected from the middle region of C1ORF166 (NP_078820). Peptide sequence GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQ.
Molecular Weight of Antigen 40 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 79594
Test Specificity Expected identity based on immunogen sequence: Crab-eating macaque (100%), Giant panda (92%).
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.