MUM1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP325002

Catalog No. NB301450

Description

MUM1 Polyclonal antibody specifically detects MUM1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: MUM1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: EXPAND1, FLJ14868, FLJ22283, melanoma associated antigen (mutated) 1, melanoma ubiquitous mutated protein, MGC131891, MGC163315, MUM-1HSPC211, Mutated melanoma-associated antigen 1, Protein expandere, PWWP domain-containing protein MUM1
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein MUM1 using the following amino acid sequence: PVRKSIQQDVLGTKLPQLSKGSPEEPVVGCPLGQRQPCRKMLPDRSRAARDRANQKLVEYIVKAKGAESHLRAILKSRKPSRW
• Quantity: 100 μL
• Research Discipline: Melanoma Cell Markers
• Gene ID (Entrez): 84939
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified