MURF2 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP233691	0.1 mL
NB436787	25 μL

Catalog No. NBP233691 Supplier Novus Biologicals Supplier No. NBP233691

Description

Rabbit Polyclonal Antibody has been used in 1 publication

MURF2 Polyclonal specifically detects MURF2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MURF2
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Western Blot Reported in scientific literature (PMID: 30685767)., Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Accession No.: Q9BYV6
• Gene Alias: MuRF2, MURF-2, Muscle-specific RING finger protein 2, RING finger protein 29muscle specific ring finger 2, RNF29, tripartite motif containing 55, tripartite motif-containing 55, tripartite motif-containing protein 55
• Gene Symbols: TRIM55
• Host Species: Rabbit
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SNDRVQGVISQLEDTCKTIEECCRKQKQELCEKFDYLYGILEERKNEMTQVITRTQEEKLEHVRALIK
• Purification Method: Affinity Purified
• Quantity: 0.1 mL
• Regulatory Status: RUO
• Research Discipline: Zinc Finger
• Primary or Secondary: Primary
• Gene ID (Entrez): 84675
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only