Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MURF3 Antibody, Novus Biologicals™

MURF3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15289920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15289920 20 μL
NBP152899 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15289920 Supplier Novus Biologicals Supplier No. NBP15289920UL

Description

Rabbit Polyclonal Antibody

MURF3 Polyclonal specifically detects MURF3 in Human samples. It is validated for Western Blot.

Specifications

Antigen MURF3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Alias MuRF, MuRF3, MURF-3, MURFtripartite motif-containing protein 54, Muscle-specific RING finger protein, Muscle-specific RING finger protein 3, RING finger protein 30muscle-specific RING-finger protein 3, RNF30, tripartite motif containing 54, tripartite motif-containing 54
Gene Symbols TRIM54
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TRIM54(tripartite motif-containing 54) The peptide sequence was selected from the N terminal of TRIM54. Peptide sequence NFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCA.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 57159
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.