Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications
$416.50 - $706.00
Specifications
Antigen | Muscarinic Acetylcholine Receptor M1/CHRM1 |
---|---|
Dilution | Western Blot Reported in scientific literature (PMID: 24658304)., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence Validated from a verified customer review., Immunohistochemistry-Paraffin 1:1000 - 1:2500, Immunohistochemistry-Frozen Reported in scientific literature (PMID: 24658304)., Immunohistochemistry Free-Floating Reported in scientific literature (PMID: 31785263). |
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen), Immunohistochemistry (Free Floating) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Muscarinic Acetylcholine Receptor M1/CHRM1 Polyclonal specifically detects Muscarinic Acetylcholine Receptor M1/CHRM1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Immunohistochemistry Free-Floating.Specifications
Muscarinic Acetylcholine Receptor M1/CHRM1 | |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen), Immunohistochemistry (Free Floating) | |
Unconjugated | |
RUO | |
Human, Mouse, Rat | |
cholinergic receptor, muscarinic 1, HM1, M1, M1R, MGC30125, muscarinic acetylcholine receptor M1 | |
CHRM1 | |
IgG | |
Affinity Purified | |
Specificity of human Muscarinic Acetylcholine Receptor M1/CHRM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot Reported in scientific literature (PMID: 24658304)., Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence Validated from a verified customer review., Immunohistochemistry-Paraffin 1:1000 - 1:2500, Immunohistochemistry-Frozen Reported in scientific literature (PMID: 24658304)., Immunohistochemistry Free-Floating Reported in scientific literature (PMID: 31785263). | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication, GPCR, Neuronal Cell Markers, Neuroscience, Neurotransmission, Transcription Factors and Regulators | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
1128 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:SETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title