mut-7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156477

Catalog No. NBP156477

Description

mut-7 Polyclonal specifically detects mut-7 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: mut-7
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: EXD3
• Immunogen: Synthetic peptides corresponding to FLJ20433(hypothetical protein FLJ20433) The peptide sequence was selected from the N terminal of FLJ20433. Peptide sequence MGPAGCAFTLLLLLGISVCGQPVYSSRVVGGQDAAAGRWPWQVSLHFDHN.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human, Goat
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: EC 3.1, exonuclease 3'-5' domain containing 3, Exonuclease 3'-5' domain-containing protein 3, FLJ20433, FLJ30442, LOC54932, MGC131904, MGC74981, mut-7, probable exonuclease mut-7 homolog
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54932
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.