MxA/Mx1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25617525UL

Catalog No. NB394617

Description

MxA/Mx1 Polyclonal specifically detects MxA/Mx1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: MxA/Mx1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: human interferon-regulated resistance GTP-binding protein MXA10IFI-78Khomolog of murine (interferon-inducibleprotein p78), myxovirus (influenza virus) resistance 1, interferon-inducible protein p78(mouse)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: MX1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEEIFQHLMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLK
• Quantity: 25 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 4599
• Target Species: Human
• Isotype: IgG

For Research Use Only