Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Mxi1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25835625UL
Description
Mxi1 Polyclonal specifically detects Mxi1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Mxi1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
BHLHC11, Class C basic helix-loop-helix protein 11, MAX dimerization protein 2, MAX interacting protein 1, MAX interactor 1bHLHc11MAD2, max-interacting protein 1, Max-related transcription factor, MGC43220, MXD2, MXI | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
MXI1 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRSTH | |
25 μL | |
Cell Cycle and Replication | |
4601 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction