Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MYBPH Antibody, Novus Biologicals™
SDP

Catalog No. NBP159131 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159131 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159131 Supplier Novus Biologicals Supplier No. NBP159131
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

MYBPH Polyclonal specifically detects MYBPH in Human samples. It is validated for Western Blot.

Specifications

Antigen MYBPH
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q13203
Gene Alias H-protein, myBP-H, myosin binding protein H, myosin-binding protein H
Gene Symbols MYBPH
Host Species Rabbit
Immunogen Synthetic peptides corresponding to MYBPH(myosin binding protein H) The peptide sequence was selected from the N terminal of MYBPH (NP_004988). Peptide sequence LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP.
Molecular Weight of Antigen 52 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4608
Test Specificity Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Equine: 92%; Bovine: 85%; Guinea pig: 85%.
Reconstitution Reconstitute with 50μL distilled water to a final concentration of 1mg/mL.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.