MYCL1/L-Myc Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP255735	100 μL

Catalog No. NBP255735 Supplier Novus Biologicals Supplier No. NBP255735

Description

Rabbit Polyclonal Antibody

MYCL1/L-Myc Polyclonal specifically detects MYCL1/L-Myc in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: MYCL1/L-Myc
• Applications: Immunocytochemistry, Immunofluorescence
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Alias: BHLHE38, bHLHe38myc-related gene from lung cancer, Class E basic helix-loop-helix protein 38, LMYCl-myc-1 proto-oncogene, MYCL, protein L-Myc-1, v-myc avian myelocytomatosis viral oncogene homolog 1, lung carcinoma derived, v-myc myelocytomatosis viral oncogene homolog 1, lung carcinoma derived (avian)
• Gene Symbols: MYCL1
• Host Species: Rabbit
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYAS
• Purification Method: Affinity Purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Research Discipline: Breast Cancer
• Primary or Secondary: Primary
• Gene ID (Entrez): 4610
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only