Myeloperoxidase/MPO Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238922

Catalog No. NBP238922

Description

Myeloperoxidase/MPO Polyclonal specifically detects Myeloperoxidase/MPO in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Myeloperoxidase/MPO
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Gene Accession No.: P05164
• Gene Symbols: MPO
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GAAPAVLGEVDTSLVLSSMEEAKQLVDKAYKERRESIKQRLR
• Quantity: 0.1 mL
• Research Discipline: Cell Biology, Immunology, Innate Immunity, Lipid and Metabolism
• Gene ID (Entrez): 4353
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 1.11.1, EC 1.11.1.7, myeloperoxidase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.