Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MYF6 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB123277 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB123277 100 μg
NB123278 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB123277 Supplier Novus Biologicals Supplier No. NBP309188100UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

MYF6 Polyclonal specifically detects MYF6 in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

Antigen MYF6
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Formulation PBS buffer, 2% sucrose
Gene Alias bHLHc4BHLHC4, Class C basic helix-loop-helix protein 4, MRF4, MRF4myogenic factor 6, Muscle-specific regulatory factor 4, Myf-6, myogenic factor 6 (herculin)
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MYF6 (NP_002460). Peptide sequence PGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEA
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4618
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.