Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MYH6 Antibody (CL2148), Novus Biologicals™

MYH6 Antibody (CL2148), Novus Biologicals™
SDP

Catalog No. NBP236744 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP236744 0.1 mL
NB436407 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP236744 Supplier Novus Biologicals Supplier No. NBP236744
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

MYH6 Monoclonal specifically detects MYH6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen MYH6
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL2148
Conjugate Unconjugated
Dilution Western Blot 1:500-1:1000, Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P13533
Gene Alias alpha-MHC, ASD3, cardiomyopathy, CMD1EE, CMH14, Hypertrophic 1, MYHC, MYHCA, myHC-alpha, Myosin Heavy Chain 6, Myosin Heavy Chain, Cardiac Muscle Alpha Isoform, Myosin, Heavy Chain 6, Cardiac Muscle, Alpha, Myosin, Heavy Polypeptide 6, Cardiac Muscle, Alpha (Cardiomyopathy, Hypertrophic 1), myosin-6, SSS3
Gene Symbols MYH6
Host Species Mouse
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QVEEDKVNSLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEA
Purification Method Protein A purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4624
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reconstitution Protein A purified
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.