Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MYL9 Antibody, Novus Biologicals™

MYL9 Antibody, Novus Biologicals™
SDP

Catalog No. NBP155383 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP155383 100 μL
NBP15538320 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP155383 Supplier Novus Biologicals Supplier No. NBP155383
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

MYL9 Polyclonal specifically detects MYL9 in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen MYL9
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P24844
Gene Alias LC2020 kDa myosin light chain, MLC2Myosin RLC, MRLC1MLC-2C, myosin regulatory light chain 1, Myosin regulatory light chain 2, smooth muscle isoform, Myosin regulatory light chain 9, Myosin regulatory light chain MRLC1, myosin regulatory light polypeptide 9, myosin, light chain 9, regulatory, myosin, light polypeptide 9, regulatory, MYRL2MGC3505
Gene Symbols MYL9
Host Species Rabbit
Immunogen Synthetic peptides corresponding to MYL9(myosin, light chain 9, regulatory) The peptide sequence was selected from the middle region of MYL9. Peptide sequence FDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEF.
Molecular Weight of Antigen 20 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10398
Reconstitution Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Sheep, Zebrafish
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.