MYL9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155383

Catalog No. NBP155383

Description

MYL9 Polyclonal specifically detects MYL9 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: MYL9
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: LC2020 kDa myosin light chain, MLC2Myosin RLC, MRLC1MLC-2C, myosin regulatory light chain 1, Myosin regulatory light chain 2, smooth muscle isoform, Myosin regulatory light chain 9, Myosin regulatory light chain MRLC1, myosin regulatory light polypeptide 9, myosin, light chain 9, regulatory, myosin, light polypeptide 9, regulatory, MYRL2MGC3505
• Host Species: Rabbit
• Molecular Weight of Antigen: 20 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P24844
• Gene Symbols: MYL9
• Immunogen: Synthetic peptides corresponding to MYL9(myosin, light chain 9, regulatory) The peptide sequence was selected from the middle region of MYL9. Peptide sequence FDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10398
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Sheep, Zebrafish
• Isotype: IgG