Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MYL9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $499.50

Specifications

Antigen	MYL9
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15538320 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15538320UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP155383 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP155383	100 μL	Each for $499.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

MYL9 Polyclonal specifically detects MYL9 in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen	MYL9
Classification	Polyclonal
Host Species	Rabbit
Formulation	PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias	LC2020 kDa myosin light chain, MLC2Myosin RLC, MRLC1MLC-2C, myosin regulatory light chain 1, Myosin regulatory light chain 2, smooth muscle isoform, Myosin regulatory light chain 9, Myosin regulatory light chain MRLC1, myosin regulatory light polypeptide 9, myosin, light chain 9, regulatory, myosin, light polypeptide 9, regulatory, MYRL2MGC3505
Gene Symbols	MYL9
Isotype	IgG
Reconstitution	Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
Molecular Weight of Antigen	20 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	P24844
Gene ID (Entrez)	10398
Immunogen	Synthetic peptides corresponding to MYL9(myosin, light chain 9, regulatory) The peptide sequence was selected from the middle region of MYL9. Peptide sequence FDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEF.
Primary or Secondary	Primary
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

MYL9 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents