Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP154903

MYLIP Antibody, Novus Biologicals™
SDP

Catalog No. NBP154903 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP154903 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP154903 Supplier Novus Biologicals Supplier No. NBP154903
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

MYLIP Polyclonal specifically detects MYLIP in Human samples. It is validated for Western Blot.

Specifications

Antigen MYLIP
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8WY64
Gene Alias band 4.1 superfamily member BZF1, BZF1, cellular modulator of immune recognition (c-MIR), EC 6.3.2.-, Idol, IDOLmyosin regulatory light chain-interacting protein, Inducible degrader of the LDL-receptor, MIRE3 ubiquitin-protein ligase MYLIP, myosin regulatory light chain interacting proteinE3 ubiquitin ligase-inducible degrader of the low density lipoprotein receptor
Gene Symbols MYLIP
Host Species Rabbit
Immunogen Synthetic peptides corresponding to MYLIP(myosin regulatory light chain interacting protein) The peptide sequence was selected from the middle region of MYLIP. Peptide sequence CSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCE.
Molecular Weight of Antigen 50 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism, Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 29116
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.