Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Myocardin Antibody, Novus Biologicals™
SDP

Catalog No. NBP1741320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1741320 20 μL
NBP174113 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1741320 Supplier Novus Biologicals Supplier No. NBP17411320UL

Rabbit Polyclonal Antibody

Myocardin Polyclonal specifically detects Myocardin in Mouse samples. It is validated for Western Blot.

Specifications

Antigen Myocardin
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q6W8X1
Gene Alias MYCD, myocardin
Gene Symbols MYOCD
Host Species Rabbit
Immunogen Synthetic peptides corresponding to the N terminal of Myocd. Immunizing peptide sequence KSLGDSKNRHKKPKDPKPKVKKLKYHQYIPPDQKAEKSPPPMDSAYARLL.
Molecular Weight of Antigen 106 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 93649
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.