Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Myocardin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
| Antigen | Myocardin |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1741320
|
Novus Biologicals
NBP17411320UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP174113
|
Novus Biologicals
NBP174113 |
100 μL |
Each for $499.50
|
|
|||||
Description
Myocardin Polyclonal specifically detects Myocardin in Mouse samples. It is validated for Western Blot.Specifications
| Myocardin | |
| Polyclonal | |
| Rabbit | |
| Q6W8X1 | |
| 93649 | |
| Synthetic peptides corresponding to the N terminal of Myocd. Immunizing peptide sequence KSLGDSKNRHKKPKDPKPKVKKLKYHQYIPPDQKAEKSPPPMDSAYARLL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| MYCD, myocardin | |
| MYOCD | |
| IgG | |
| 106 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title