Myosin 1C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP153071

Catalog No. NBP153071

Description

Myosin 1C Polyclonal specifically detects Myosin 1C in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Myosin 1C
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ23903, MMIb, MMI-beta, Myosin I beta, myosin IC, myosin-I beta, myosin-Ic, myr2, NMI, nuclear myosin I
• Host Species: Rabbit
• Molecular Weight of Antigen: 118 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: MYO1C isoforms 1, 2 and 3.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O00159-2
• Gene Symbols: MYO1C
• Immunogen: Synthetic peptides corresponding to MYO1C(myosin IC) The peptide sequence was selected from the N terminal of MYO1C (NP_203693). Peptide sequence NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4641
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only