Myosin Heavy Chain 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157681

Catalog No. NBP157681

Description

Myosin Heavy Chain 1 Polyclonal specifically detects Myosin Heavy Chain 1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Myosin Heavy Chain 1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MyHC-2x, MYH1, MYH1 myosin, heavy chain 1, skeletal muscle, adult MYHa, MYHC 1, MYHC1, MYHC-1, MyHC-2X/D, MYHSA1
• Host Species: Rabbit
• Molecular Weight of Antigen: 223 kDa
• Quantity: 100 μL
• Research Discipline: Cytoskeleton Markers, Hypoxia
• Gene ID (Entrez): 4619
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P12882
• Gene Symbols: MYH1
• Immunogen: Synthetic peptide corresponding to Myosin heavy chain 1 (myosin, heavy chain 1, skeletal muscle, adult) directed towards the N terminal of Myosin heavy chain 1. Peptide sequence: KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Canine: 92%; Pig: 92%; Chicken: 76%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Isotype: IgG

For Research Use Only