Learn More
Description
Specifications
Specifications
| Antigen | Myosin Light Chain 2 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000, Immunohistochemistry-Frozen |
| Formulation | PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | cardiac ventricular myosin light chain 2, CMH10myosin light chain 2, DKFZp779C0562, MLC2, MLC-2, MLC-2v, myosin regulatory light chain 2, ventricular/cardiac muscle isoform, myosin, light chain 2, regulatory, cardiac, slow, myosin, light polypeptide 2, regulatory, cardiac, slow, regulatory light chain of myosin, RLC of myosin, slow cardiac myosin regulatory light chain 2 |
| Gene Symbols | MYL2 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGE |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
