Myosin Light Chain 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP18554125UL

Catalog No. NB406517

Description

Myosin Light Chain 2 Polyclonal specifically detects Myosin Light Chain 2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.

Specifications

• Antigen: Myosin Light Chain 2
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000, Immunohistochemistry-Frozen
• Gene Alias: cardiac ventricular myosin light chain 2, CMH10myosin light chain 2, DKFZp779C0562, MLC2, MLC-2, MLC-2v, myosin regulatory light chain 2, ventricular/cardiac muscle isoform, myosin, light chain 2, regulatory, cardiac, slow, myosin, light polypeptide 2, regulatory, cardiac, slow, regulatory light chain of myosin, RLC of myosin, slow cardiac myosin regulatory light chain 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4633
• Target Species: Human, Mouse
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: MYL2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGE
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only