N-Acetyl-D-Glucosamine Kinase/NAGK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23824025UL

Catalog No. NB396917

Description

N-Acetyl-D-Glucosamine Kinase/NAGK Polyclonal specifically detects N-Acetyl-D-Glucosamine Kinase/NAGK in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: N-Acetyl-D-Glucosamine Kinase/NAGK
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9UJ70
• Gene Symbols: NAGK
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSE
• Quantity: 25 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 55577
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 2.7.1.59, GNKGlcNAc kinase, N-acetyl-D-glucosamine kinase, N-acetylglucosamine kinaseHSA242910
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.