Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. N-Cadherin Antibody (CL3716), Novus Biologicals™

N-Cadherin Antibody (CL3716), Novus Biologicals™
SDP

Catalog No. NBP261632 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP261632 100 μL
NB393091 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP261632 Supplier Novus Biologicals Supplier No. NBP261632
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

N-Cadherin Monoclonal specifically detects N-Cadherin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen N-Cadherin
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
Classification Monoclonal
Clone CL3716
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000, KnockDown Validated
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias cadherin 2, N-cadherin (neuronal), cadherin 2, type 1, N-cadherin (neuronal), cadherin-2, CD325, CD325 antigen, CDHNcalcium-dependent adhesion protein, neuronal, CDw325, N-cadherin, NCADN-cadherin 1, Neural cadherin, neural-cadherin
Gene Symbols CDH2
Host Species Mouse
Immunogen This N-Cadherin Antibody (CL3716) was developed against a recombinant protein corresponding to amino acids: NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDP.
Molecular Weight of Antigen 100 kDa
Purification Method Protein A purified
Quantity 100 μL
Research Discipline Cancer, Cell Cycle and Replication, Cellular Markers, Extracellular Matrix, Mesenchymal Stem Cell Markers, Neuroscience, Plasma Membrane Markers, Signal Transduction, Stem Cells
Primary or Secondary Primary
Gene ID (Entrez) 1000
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.