N-Cadherin Antibody (CL3716), Novus Biologicals™

Mouse Monoclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP261632	Novus Biologicals NBP261632	100 μL
NB393091	Novus Biologicals NBP26163225UL	25 μL

Description

N-Cadherin Monoclonal specifically detects N-Cadherin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: N-Cadherin
• Dilution: Western Blot 1 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000, KnockDown Validated
• Conjugate: Unconjugated
• Host Species: Mouse
• Target Species: Human
• Gene ID (Entrez): 1000
• Immunogen: This N-Cadherin Antibody (CL3716) was developed against a recombinant protein corresponding to amino acids: NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDP.
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Clone: CL3716
• Classification: Monoclonal
• Form: Purified
• Research Discipline: Cancer, Cell Cycle and Replication, Cellular Markers, Extracellular Matrix, Mesenchymal Stem Cell Markers, Neuroscience, Plasma Membrane Markers, Signal Transduction, Stem Cells
• Gene Alias: cadherin 2, N-cadherin (neuronal), cadherin 2, type 1, N-cadherin (neuronal), cadherin-2, CD325, CD325 antigen, CDHNcalcium-dependent adhesion protein, neuronal, CDw325, N-cadherin, NCADN-cadherin 1, Neural cadherin, neural-cadherin
• Gene Symbols: CDH2
• Isotype: IgG1
• Purification Method: Protein A purified
• Molecular Weight of Antigen: 100 kDa