Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

N-Cadherin Rabbit anti-Human, Mouse, Rat, Clone: 6F9G8, Novus Biologicals™
SDP

Catalog No. NB166403 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB166403 100 μg
NB166404 20 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB166403 Supplier Novus Biologicals Supplier No. NBP315654100UL
Add to Cart
Add to Cart
This item is not returnable. View return policy

Rabbit Monoclonal Antibody

N-Cadherin Monoclonal antibody specifically detects N-Cadherin in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown

Specifications

Antigen N-Cadherin
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
Classification Monoclonal
Clone 6F9G8
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockout Validated
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias ACOGS, ARVD14, cadherin 2, type 1, N-cadherin (neuronal), cadherin-2, calcium-dependent adhesion protein, neuronal, CD325, CD325 antigen, CDH2, CDHN, CDw325, NCAD, N-cadherin, N-cadherin 1, Neural cadherin, neural-cadherin
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human N-Cadherin (P19022). AKFLIYAQDKETQEKWQVAVKLSLKPTLTEESVKESAEVEEIVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGP
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cancer, Cell Cycle and Replication, Cellular Markers, Extracellular Matrix, Mesenchymal Stem Cell Markers, Neuroscience, Plasma Membrane Markers, Signal Transduction, Stem Cells
Primary or Secondary Primary
Gene ID (Entrez) 1000
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.