Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody, Novus Biologicals™

N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody, Novus Biologicals™
SDP

Catalog No. NB397019 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB397019 25 μL
NBP237978 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB397019 Supplier Novus Biologicals Supplier No. NBP23797825UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

N-Deacetylase/N-Sulfotransferase 1/NDST1 Polyclonal specifically detects N-Deacetylase/N-Sulfotransferase 1/NDST1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen N-Deacetylase/N-Sulfotransferase 1/NDST1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P52848
Gene Alias [Heparan sulfate]-glucosamine N-sulfotransferase 1, bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1, EC 2.8.2.8, Glucosaminyl N-deacetylase/N-sulfotransferase 1, heparan sulfate-N-deacetylase/N-sulfotransferase, HSNST 1, HSST1, HSSTN-HSST 1, N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1, NDST-1, N-heparan sulfate sulfotransferase 1, NST1
Gene Symbols NDST1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: YEPVLLAKTRSSESIPHLGADAGLHAALHATVVQ
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3340
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.