Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. N-PAC Antibody, Novus Biologicals™

N-PAC Antibody, Novus Biologicals™
SDP

Catalog No. NB436155 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB436155 25 μL
NBP238618 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB436155 Supplier Novus Biologicals Supplier No. NBP23861825UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

N-PAC Polyclonal specifically detects N-PAC in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen N-PAC
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q49A26
Gene Alias BM045, Cytokine-like nuclear factor N-PAC, Glyoxylate reductase 1 homolog, glyoxylate reductase 1 homolog (Arabidopsis), HIBDLnuclear protein 60 kDa, NP603-hydroxyisobutyrate dehydrogenase-like protein, N-PAC, nuclear protein 60kDa, Nuclear protein NP60, Nuclear protein of 60 kDa, putative oxidoreductase GLYR1
Gene Symbols GLYR1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIV
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 84656
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.