Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
N4BP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31727725UL
Description
N4BP2 Polyclonal antibody specifically detects N4BP2 in Human samples. It is validated for Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
N4BP2 | |
Polyclonal | |
Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
B3BPKIAA1413, BCL-3-binding protein, EC 3.-, FLJ10680, NEDD4 binding protein 2, NEDD4-binding protein 2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: GLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLISHSFRFSEIKPGCLKVMLK | |
25 μg | |
Primary | |
Human | |
Purified |
Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
55728 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction