NAA25 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18839125UL

Catalog No. NB431346

Description

NAA25 Polyclonal specifically detects NAA25 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NAA25
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: C12orf30DKFZp667K2112, chromosome 12 open reading frame 30, FLJ13089, MDM20mitochondrial distribution and morphology 20, Mitochondrial distribution and morphology protein 20, N(alpha)-acetyltransferase 25, NatB auxiliary subunit, N-alpha-acetyltransferase 25, NatB auxiliary subunit, NAP1, NatB complex subunit MDM20, N-terminal acetyltransferase B complex subunit MDM20, N-terminal acetyltransferase B complex subunit NAA25, p120
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 80018
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: NAA25
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TGKRFIEKDIQYPFLGPVPTRMGGFFNSGCSQCQISSFYLVNDIYELDTSGLEDTMEIQERIENSFKSLLDQLKDVFSKCKGDLL
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only