NALP12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18555525UL

Catalog No. NB406510

Description

NALP12 Polyclonal specifically detects NALP12 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NALP12
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: FCAS2, Monarch-1, NACHT, leucine rich repeat and PYD containing 12, NACHT, LRR and PYD domains-containing protein 12, NALP12LRR and PYD containing protein 12, NLR family, pyrin domain containing 12, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 12, PYPAF7Monarch1, PYRIN-containing APAF1-like protein 7, Regulated by nitric oxide, RNO2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: NLRP12
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LKRCRSAQVLHLYGATYSADGEDRARCSAGAHTLLVQLPERTVLLDAYSEHLAAALCTNPNLIELSLYRNALGS
• Quantity: 25 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 91662
• Target Species: Human
• Isotype: IgG

For Research Use Only