NAP1L2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157024

Catalog No. NBP157024

Description

NAP1L2 Polyclonal specifically detects NAP1L2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NAP1L2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BPXMGC26243, brain specific gene BPX, Brain-specific protein, X-linked, nucleosome assembly protein 1-like 2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Rabbit: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P51860
• Gene Symbols: NAP1L2
• Immunogen: Synthetic peptides corresponding to NAP1L2 (nucleosome assembly protein 1-like 2) The peptide sequence was selected from the middle region of NAP1L2. Peptide sequence VDTLTPLIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNE.
• Quantity: 100 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 4674
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.