Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NAP1L2 Antibody, Novus Biologicals™

NAP1L2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15702420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15702420 20 μL
NBP157024 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15702420 Supplier Novus Biologicals Supplier No. NBP15702420UL

Description

Rabbit Polyclonal Antibody

NAP1L2 Polyclonal specifically detects NAP1L2 in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen NAP1L2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P51860
Gene Alias BPXMGC26243, brain specific gene BPX, Brain-specific protein, X-linked, nucleosome assembly protein 1-like 2
Gene Symbols NAP1L2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to NAP1L2 (nucleosome assembly protein 1-like 2) The peptide sequence was selected from the middle region of NAP1L2. Peptide sequence VDTLTPLIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNE.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 4674
Target Species Human, Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.