NAPRT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP18724425UL

Catalog No. NB406160

Description

NAPRT1 Polyclonal specifically detects NAPRT1 in Human, Mouse, Chinese Hamster samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NAPRT1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q6XQN6
• Gene Symbols: NAPRT1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGP
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 93100
• Target Species: Human, Mouse, Chinese Hamster
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 2.4.2.11, FHA-HIT-interacting protein, FHIP, NAPRTase, nicotinate phosphoribosyltransferase, nicotinate phosphoribosyltransferase domain containing 1, Nicotinate phosphoribosyltransferase domain-containing protein 1, nicotinic acid phosphoribosyltransferase, PP3856
• Host Species: Rabbit
• Molecular Weight of Antigen: 57 kDa
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human NAPRT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only