NAPRT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB406160	Novus Biologicals NBP18724425UL	25 μL
NBP187244	Novus Biologicals NBP187244	0.1 mL

Description

NAPRT1 Polyclonal specifically detects NAPRT1 in Human, Mouse, Chinese Hamster samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NAPRT1
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 2.4.2.11, FHA-HIT-interacting protein, FHIP, NAPRTase, nicotinate phosphoribosyltransferase, nicotinate phosphoribosyltransferase domain containing 1, Nicotinate phosphoribosyltransferase domain-containing protein 1, nicotinic acid phosphoribosyltransferase, PP3856
• Gene Symbols: NAPRT1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of human NAPRT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human, Mouse, Chinese Hamster
• Gene Accession No.: Q6XQN6
• Gene ID (Entrez): 93100
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGP
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Molecular Weight of Antigen: 57 kDa

For Research Use Only