NAT9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP153194

Catalog No. NBP153194

Description

NAT9 Polyclonal specifically detects NAT9 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NAT9
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZP564C103, EBS, EBSP, hNATL, EC 2.3.1.-, embryo brain specific protein, Embryo brain-specific protein, N-acetyltransferase 9, N-acetyltransferase 9 (GCN5-related, putative)
• Host Species: Rabbit
• Molecular Weight of Antigen: 23 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Goat: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BTE0
• Gene Symbols: NAT9
• Immunogen: Synthetic peptides corresponding to NAT9(N-acetyltransferase 9 (GCN5-related, putative)) Antibody(against the N terminal of NAT9. Peptide sequence MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQ.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26151
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.