Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NAT9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | NAT9 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
NAT9 Polyclonal specifically detects NAT9 in Human samples. It is validated for Western Blot.Specifications
NAT9 | |
Polyclonal | |
Rabbit | |
Q9BTE0 | |
26151 | |
Synthetic peptides corresponding to NAT9(N-acetyltransferase 9 (GCN5-related, putative)) Antibody(against the N terminal of NAT9. Peptide sequence MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQ. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DKFZP564C103, EBS, EBSP, hNATL, EC 2.3.1.-, embryo brain specific protein, Embryo brain-specific protein, N-acetyltransferase 9, N-acetyltransferase 9 (GCN5-related, putative) | |
NAT9 | |
IgG | |
23 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title