Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Nav1.6 Antibody, Novus Biologicals™
SDP

Catalog No. NB236148 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB236148 100 μg
NB237400 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB236148 Supplier Novus Biologicals Supplier No. NBP321269100UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Nav1.6 Polyclonal antibody specifically detects Nav1.6 in Human samples. It is validated for Immunofluorescence

Specifications

Antigen Nav1.6
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias CerIII, hNa6/Scn8a voltage-gated sodium channel, MED, NaCh6, Nav1.6, PN4, sodium channel protein type 8 subunit alpha, Sodium channel protein type VIII subunit alpha, sodium channel, voltage gated, type VIII, alpha polypeptide, sodium channel, voltage gated, type VIII, alpha subunit, Voltage-gated sodium channel subunit alpha Nav1.6
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: EMNNLQISVIRIKKGVAWTKLKVHAFMQAHFKQREADEVKPLDELYEKKANCIANHTGADIHRNGDFQKNGNGTT
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Neurodegeneration, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 6334
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.